PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000300.1_g00043.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family CAMTA
Protein Properties Length: 911aa    MW: 103145 Da    PI: 7.5426
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000300.1_g00043.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1161.41.6e-50301463118
                     CG-1   3 ke.kkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYah 87 
                              +e ++rwl+++ei+aiL n++ ++++  + + pk g++ L++rkk+r+frkDG++wkkkkdgktv+E+he+LKvg+ e +++yYah
  Itr_sc000300.1_g00043.1  30 DEaRTRWLRPNEIHAILCNYKYFTVHVRPVNLPKGGTVTLFDRKKLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGNDERIHVYYAH 115
                              4559********************************************************************************** PP

                     CG-1  88 seenptfqrrcywlLeeelekivlvhylevk 118
                              +e+nptf rrcywlL+++le+ivlvhy+e++
  Itr_sc000300.1_g00043.1 116 GEDNPTFVRRCYWLLDKTLEHIVLVHYRETQ 146
                              ****************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143776.2525151IPR005559CG-1 DNA-binding domain
SMARTSM010761.6E-7128146IPR005559CG-1 DNA-binding domain
PfamPF038594.9E-4531144IPR005559CG-1 DNA-binding domain
SuperFamilySSF812963.08E-15360447IPR014756Immunoglobulin E-set
Gene3DG3DSA:2.60.40.104.7E-5360440IPR013783Immunoglobulin-like fold
PfamPF018331.2E-4361445IPR002909IPT domain
Gene3DG3DSA:1.25.40.201.4E-16541659IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484034.51E-17544660IPR020683Ankyrin repeat-containing domain
CDDcd002042.20E-16546656No hitNo description
PfamPF127965.0E-7547625IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029715.247555668IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5008811.087597629IPR002110Ankyrin repeat
SMARTSM002484.1E-5597626IPR002110Ankyrin repeat
SMARTSM00015440705729IPR000048IQ motif, EF-hand binding site
SuperFamilySSF525407.17E-5709809IPR027417P-loop containing nucleoside triphosphate hydrolase
PROSITE profilePS500966.705743769IPR000048IQ motif, EF-hand binding site
SMARTSM0001525758780IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.309759788IPR000048IQ motif, EF-hand binding site
SMARTSM000155.2E-4781803IPR000048IQ motif, EF-hand binding site
PROSITE profilePS5009610.347782806IPR000048IQ motif, EF-hand binding site
PfamPF006121.6E-4783803IPR000048IQ motif, EF-hand binding site
SMARTSM000159.5864886IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.736866894IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 911 aa     Download sequence    Send to blast
MDYGVPVLLA GSDIHGFHTL EDLDVKTVMD EARTRWLRPN EIHAILCNYK YFTVHVRPVN  60
LPKGGTVTLF DRKKLRNFRK DGHNWKKKKD GKTVKEAHEH LKVGNDERIH VYYAHGEDNP  120
TFVRRCYWLL DKTLEHIVLV HYRETQEVQS SPATPSSALS DLSPPWGLTE GSESTIDCAN  180
YNRPPASLEP NDNMRIQNHR QTLHAINTLE WEELLEPDDP NNSRSAKASG GQQQQYETNG  240
FRLNVDNLSA DKLAVGPLEN LPGQMSISNS INFNIPNDVV PQTLNAQMTS YSQRIDFDNP  300
SKDGLQSQDS FGKWINYMIA ADSPGSVDDP SLEPATLPGY QSFPSPSLDN KSSAQEHIFN  360
ITDVSPAWAF STEETKILVI GHFLGGQSQL AISNLFCVCG DTPVPAEVIQ SGVYRCLLSP  420
QTPGLVSLYL SFDGYNPISQ VITFEFRAPE MPKSTTTPSV VKHHWEELRA QMRLAHLLFA  480
TPKSLNILSS KIPQDAQKGA KIFAHKCSHI TSNWTNLTKS IDNNEFSFPQ AKDQLFELSL  540
HTKLQEWLLE RILEGCKIPE RDEQGQSVIH LCAILGYTWA IYPYKWSGLS LDYRDKFGWT  600
ALHWAAYYGR EKMVAVLLSA GAKPSMVTDP SSENPSGCTA ADLASKNGYE GLGAYLAEKA  660
LVAQFNDMTL AGNASGSLQP ASDSGNYGNI DEDMELKDTL AAYRTAADAA ARIQSAFREH  720
SFKLRKQQVE TSTPESEARS IIAAMKIQHA FRKYDSRKKI AAAARIQYRF RTWKIRKDFL  780
NMRRQATKIQ SVFRGYQVRR QYRKIVWSVG VLEKAILRWR LKRKGFRGLQ VAETTDTTEN  840
QKQDNDVVVE EDFFRASAFV RLERVERAVV RVQAMFRSKK AQEEYRRMKL EHNTASLEYE  900
EFLDPTDTYM G
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17188RKKLRNFRKDGHNWKKKK
27287KKLRNFRKDGHNWKKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00435DAPTransfer from AT4G16150Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009609050.10.0PREDICTED: calmodulin-binding transcription activator 5-like
SwissprotO234630.0CMTA5_ARATH; Calmodulin-binding transcription activator 5
TrEMBLA0A068TRD50.0A0A068TRD5_COFCA; Uncharacterized protein
TrEMBLH8ZRY60.0H8ZRY6_SOLLC; Calmodulin-binding transcription factor SR3L
STRINGVIT_05s0077g01240.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45652232
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16150.10.0calmodulin binding;transcription regulators